Cat#:FPA-40187P;Product Name:Rabbit Anti-STARS Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within C terminal aa 284-333 ( KEGSKTAERAKRAEEHIYREIMELCFVIRTMARHRRDGKIQVTFGELFDR ) of Mouse STARS (NP_780665). ;Species Reactivity:Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Pig, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 2% Sucrose, 97% PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within C terminal aa 284-333 ( KEGSKTAERAKRAEEHIYREIMELCFVIRTMARHRRDGKIQVTFGELFDR ) of Mouse STARS (NP_780665).
Species Reactivity:
Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Pig, Zebrafish
Isotype:
IgG
Application:
WB
Storage Buffer:
Constituents: 2% Sucrose, 97% PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.