Rabbit Anti-Stanniocalcin 1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-40155P

• Product Name:
• Rabbit Anti-Stanniocalcin 1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within C terminal aa 184-233 ( EKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEG ) of Rat Stanniocalcin 1 (NP_112385)

• Species Reactivity:
• Rat Predicted to work with: Mouse, Rabbit, Horse, Cow, Cat, Dog, Human, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 98% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid