Cat#:FPA-40124P;Product Name:Rabbit Anti-ST8SIA5 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human ST8SIA5 aa 329-374. Sequence: SGLYITHHYYDNVKPRPGFHAMPSEIFNFLHLHSRGILRVHTGTCS ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS;Storage Procedures:Store at 4°C (stable for up to 12 months). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;