Rabbit Anti-SSFA2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-40034P

• Product Name:
• Rabbit Anti-SSFA2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human SSFA2 aa 1209-1259. The exact sequence is proprietary. NP_001123917.1. Sequence: MDRPLSSSAEAEEELEWQVASRRRKAWAKCRSSWQASETEDLSTEATTQD

• Species Reactivity:
• Human Predicted to work with: Sheep, Rabbit, Cat, Dog, Chimpanzee, Macaque monkey, Rhesus monkey, Gorilla, Common marmoset, Orangutan

• Isotype:
• IgG

• Application:
• IP

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7-8

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid