• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-SQSTM1 / p62 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-48468P
  • Product Name:
  • Rabbit Anti-SQSTM1 / p62 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide within Human SQSTM1/ p62 aa 387-436. The exact sequence is proprietary. Sequence: PPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH Database link: Q13501 Run BLAST with Run BLAST with
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Ammonium Sulphate Precipitation
  • Storage Procedures:
  • Preservative: 0.09% Sodium azide Constituent: 99% PBS
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-SQSTM1 / p62 Polyclonal Antibody-FPA-48467P
  • Online Inquiry

    refresh