Rabbit Anti-SPTLC1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-39868P

• Product Name:
• Rabbit Anti-SPTLC1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human SPTLC1 aa 50-100. The exact sequence is proprietary. NP_006406.1. Sequence: SDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKE C

• Species Reactivity:
• Mouse, Human Predicted to work with: Rabbit, Horse, Chicken, Guinea pig, Cow, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid