Rabbit Anti-SPO11 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-39797P

• Product Name:
• Rabbit Anti-SPO11 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human SPO11 aa 108-157 (N terminal). Sequence: AQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDI

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid