Product finder
Cat#:FPA-39786P;Product Name:Rabbit Anti-splicing factor 1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human splicing factor 1 aa 48-97. (NP_004621) Sequence: QERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTR ;Species Reactivity:Mouse, Human;Isotype:IgG;Application:ICC/IF, WB, IHC-P;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 0.87% Sodium chloride, 50% Glycerol, 49% PBS PBS (without Mg2+, Ca2+);Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Rabbit Anti-splicing factor 1 Polyclonal Antibody
Online Inquiry
- Product Name:
- Rabbit Anti-splicing factor 1 Polyclonal Antibody
- Immunogen:
- Synthetic peptide corresponding to Human splicing factor 1 aa 48-97. (NP_004621) Sequence: QERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTR
- Species Reactivity:
- Mouse, Human
- Application:
- ICC/IF, WB, IHC-P
- Storage Buffer:
- pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 0.87% Sodium chloride, 50% Glycerol, 49% PBS PBS (without Mg2+, Ca2+)
- Storage Procedures:
- Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
Pre product:Rabbit Anti-splicing factor 1 (phospho S82) Polyclonal Antibody-FPA-39785P
Next product:Rabbit Anti-splicing factor 1 Polyclonal Antibody-FPA-39787P