Rabbit Anti-SPAG7 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-39609P

• Product Name:
• Rabbit Anti-SPAG7 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Mouse SPAG7 aa 1-50 (N terminal). The exact sequence is proprietary. Sequence: MADLLGSILSSMEKPPSLGDQESRRKAREQAARLKKLQEQDKQQKVEFRK

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid