Cat#:FPA-39584P;Product Name:Rabbit Anti-Sp8 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Sp8 aa 375-424. The exact sequence is proprietary. Sequence: AHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKR ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 98% PBS, 2% Sucrose;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;