Rabbit Anti-SOX17 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-39502P

• Product Name:
• Rabbit Anti-SOX17 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human SOX17 aa 70-120. Sequence: RPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVE E

• Species Reactivity:
• Mouse, Rat, Human, Chimpanzee, Fish, Monkey, Zebrafish, Opossum

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• Preservative: 0.05% Sodium azide Constituents: 99% PBS, 0.05% BSA

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid