Rabbit Anti-Solute carrier family 22 member 18 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-39431P

• Product Name:
• Rabbit Anti-Solute carrier family 22 member 18 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to a region within N terminal aa 108-157 (AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRL G) of Human Solute carrier family 22 member 18 (NP_002546)

• Species Reactivity:
• Human Predicted to work with: Mouse, Horse, Guinea pig, Cow

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid