Rabbit Anti-SNX20 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-39328P

• Product Name:
• Rabbit Anti-SNX20 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human SNX20 aa 41-90 (N terminal). The exact sequence is proprietary. NP_699168 Sequence: GHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKV

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid