Cat#:FPA-39251P;Product Name:Rabbit Anti-SNRNP200 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human SNRNP200 aa 400-450. The exact sequence is proprietary. NP_054733.2 Sequence: GEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPA L ;Species Reactivity:Mouse, Human;Isotype:IgG;Application:WB, IP;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7.0-8.0;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human SNRNP200 aa 400-450. The exact sequence is proprietary. NP_054733.2 Sequence: GEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPA L
Species Reactivity:
Mouse, Human
Isotype:
IgG
Application:
WB, IP
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7.0-8.0
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.