Rabbit Anti-SNAPC3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-39212P

• Product Name:
• Rabbit Anti-SNAPC3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal sequence aa 216-265 ( RDSIRCVSDLQIGGEFSNTPDQAPEHISKDLYKSAFFYFEGTFYNDKRYP ) of Human SNAPC3 (NP_001034786).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: 0% None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Store at -20°C. Stable for 12 months at -20°C.

• Clonality:
• Polyclonal

• Form:
• Liquid