Cat#:FPA-39105P;Product Name:Rabbit Anti-SMIM12 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human SMIM12 aa 31-92. Sequence: LEWFIRGKDPQPVEEEKSISERREDRKLDELLGKDHTQVVSLKDKLEFAP KAVLNRNRPEKN ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:IHC-P, WB;Storage Buffer:pH: 7.20 Preservative: 0.02% Sodium azide Constituents: PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;