Cat#:FPA-39082P;Product Name:Rabbit Anti-SMC6L1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide: PQSMSSLPSSKLIRILRMSDPERGQTTLPFR , corresponding to C terminal aa 1050-1091 of Human SMC6L1. ;Species Reactivity:Human Predicted to work with: Mouse, Chimpanzee;Isotype:IgG;Application:IHC-P, WB, IP, ICC/IF;Storage Buffer:Preservative: 0.1% Sodium Azide Constituents: 8mM PBS, 60mM Citrate, 150mM Tris, pH 7-8;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.;