Rabbit Anti-SMC5 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-39080P

• Product Name:
• Rabbit Anti-SMC5 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide: FFITPKLLQNLPYSEKMTVLFVYNGPHMLEP , corresponding to C terminal aa 1050-1101 of Human SMC5, using the numbering given in TrEMBL entry Q8IY18 (GeneID 23137).

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Horse, Guinea pig, Cow, Dog, Pig, Chimpanzee, Ferret, Rhesus monkey, Gorilla, Orangutan

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Buffer:
• Preservative: 0.1% Sodium Azide Constituents: 8mM PBS, 60mM Citrate, 150mM Tris, pH 7-8

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid