Rabbit Anti-Small leucine rich protein 1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48425P

• Product Name:
• Rabbit Anti-Small leucine rich protein 1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human Small leucine rich protein 1 aa 73-106. Sequence: FRIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKW Database link: H3BR10 Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid