Cat#:FPA-38871P;Product Name:Rabbit Anti-SLFN12 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within N-terminal aa 35-84 ( KLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSYTKDGIGLDLENSFS ) of Human SLFN12 (NP_060512). ;Species Reactivity:Human Predicted to work with: Cow;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.;
Synthetic peptide corresponding to a region within N-terminal aa 35-84 ( KLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSYTKDGIGLDLENSFS ) of Human SLFN12 (NP_060512).
Species Reactivity:
Human Predicted to work with: Cow
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.