Rabbit Anti-SLC2A13 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-38627P

• Product Name:
• Rabbit Anti-SLC2A13 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human SLC2A13 aa 248-278 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH). Sequence: PAVIQFFGFLFLPESPRWLIQKGQTQKARRI

• Species Reactivity:
• Mouse, Human

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid