Rabbit Anti-SLC29A4 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48392P

• Product Name:
• Rabbit Anti-SLC29A4 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human SLC29A4 aa 440-490 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: MPALRHPAWPCIFSLLMGISNGYFGSVPMILAAGKVSPKQRELAGNTMTV S Database link: Q7RTT9 Run BLAST with Run BLAST with

• Species Reactivity:
• Rat Predicted to work with: Mouse, Human

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Protein A purified

• Storage Procedures:
• Preservative: 0.09% Sodium azide Constituents: 1% BSA, 50% Glycerol

• Clonality:
• Polyclonal

• Form:
• Liquid