Rabbit Anti-SIAH1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-38180P

• Product Name:
• Rabbit Anti-SIAH1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human SIAH1 aa 217-266 (C terminal). A region within synthetic peptide corresponding to C terminal aa 217-266 of Human SIAH1 Sequence: QAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQL

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Chicken, Cow, Dog, Drosophila melanogaster, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid