Cat#:FPA-38119P;Product Name:Rabbit Anti-SHISA9 Polyclonal Antibody;Formulation:There are 3 isoforms produced by alternative splicing.;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human SHISA9 aa 122-171 (internal sequence). The exact sequence is proprietary. Sequence: NYDTPLWLNTGKPPARKDDPLHDPTKDKTNLIVYIICGVVAVMVLVGIFT ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 98% PBS, 2% Sucrose;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
There are 3 isoforms produced by alternative splicing.
Host Species:
Rabbit
Immunogen:
Synthetic peptide within Human SHISA9 aa 122-171 (internal sequence). The exact sequence is proprietary. Sequence: NYDTPLWLNTGKPPARKDDPLHDPTKDKTNLIVYIICGVVAVMVLVGIFT
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog
Isotype:
IgG
Application:
WB
Storage Buffer:
Constituents: 98% PBS, 2% Sucrose
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.