Rabbit Anti-SHCBP1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48346P

• Product Name:
• Rabbit Anti-SHCBP1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human SHCBP1 aa 622-672 (C terminal). The exact sequence is proprietary. Sequence: STQKGQIKKKRLSELGITQADDNLMSQEMFVGIVGNQFKWNGKGSFGTFL F Database link: Q8NEM2 Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8

• Clonality:
• Polyclonal

• Form:
• Liquid