Cat#:FPA-37941P;Product Name:Rabbit Anti-SFXN5 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Rat SFXN5 aa 83-132 (N terminal). The exact sequence is proprietary. NP_695210 Sequence: NEQLWSAQKIKQAILHPDTNEKIFMPFRMSGYIPFGTPIVVGLLLPNQTL ;Species Reactivity:Rat Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 98% PBS, 2% Sucrose;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Rat SFXN5 aa 83-132 (N terminal). The exact sequence is proprietary. NP_695210 Sequence: NEQLWSAQKIKQAILHPDTNEKIFMPFRMSGYIPFGTPIVVGLLLPNQTL
Species Reactivity:
Rat Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
Isotype:
IgG
Application:
WB
Storage Buffer:
Constituents: 98% PBS, 2% Sucrose
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.