Cat#:FPA-37903P;Product Name:Rabbit Anti-SFRS15 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human SFRS15 aa 601-650. AA883099 Sequence: YIPWDKVKPEELESFCEGGMLDSDTLNPDWKGIPKKPENEVAQNGGAETS ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:IHC-P, WB, ELISA;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride PBS is without Mg2+ and Ca2+;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;