Rabbit Anti-SF3A3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-37858P

• Product Name:
• Rabbit Anti-SF3A3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human SF3A3 aa 451-501 (C terminal). The exact sequence is proprietary. (NP_006793.1) Sequence: QIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSGNVVNKKTYEDLKRQGL L

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Dog, Pig, Xenopus laevis, Zebrafish, Rhesus monkey

• Isotype:
• IgG

• Application:
• WB, IP, IHC-P, ICC/IF

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 99% Tris buffered saline, 0.1% BSA

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid