• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-SF3A3 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-37858P
  • Product Name:
  • Rabbit Anti-SF3A3 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide within Human SF3A3 aa 451-501 (C terminal). The exact sequence is proprietary. (NP_006793.1) Sequence: QIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSGNVVNKKTYEDLKRQGL L
  • Species Reactivity:
  • Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Dog, Pig, Xenopus laevis, Zebrafish, Rhesus monkey
  • Isotype:
  • IgG
  • Application:
  • WB, IP, IHC-P, ICC/IF
  • Storage Buffer:
  • Preservative: 0.09% Sodium azide Constituents: 99% Tris buffered saline, 0.1% BSA
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-SF3A1 Polyclonal Antibody-FPA-37857P
  • Online Inquiry

    refresh