Cat#:FPA-37820P;Product Name:Rabbit Anti-SETD3 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human SETD3 aa 1-50 (N terminal). The exact sequence is proprietary. Sequence: MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEY ;Species Reactivity:Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Dog, Pig, Zebrafish, Rhesus monkey, Xenopus tropicalis;Isotype:IgG;Application:WB, IP;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7-8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human SETD3 aa 1-50 (N terminal). The exact sequence is proprietary. Sequence: MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEY
Species Reactivity:
Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Dog, Pig, Zebrafish, Rhesus monkey, Xenopus tropicalis
Isotype:
IgG
Application:
WB, IP
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7-8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.