Cat#:FPA-37712P;Product Name:Rabbit Anti-Serine palmitoyltransferase 3 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human Serine palmitoyltransferase 3 aa 1-58. Sequence: MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKL IVESFEEA ;Species Reactivity:Human;Isotype:IgG;Application:WB, ICC/IF;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Recombinant fragment corresponding to Human Serine palmitoyltransferase 3 aa 1-58. Sequence: MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKL IVESFEEA