Rabbit Anti-Septin 2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-37669P

• Product Name:
• Rabbit Anti-Septin 2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Septin 2 aa 275-325. The exact sequence is proprietary. Sequence: KLRTMLITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLE K

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Horse, Guinea pig, Cow, Pig, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid