Rabbit Anti-SEMA6D Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-37563P

• Product Name:
• Rabbit Anti-SEMA6D Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human SEMA6D aa 1023-1073 (C terminal). The exact sequence is proprietary. NP_705871.1. Sequence: PSLSRQSSYTSNGTLPRTGLKRTPSLKPDVPPKPSFVPQTPSVRPLNKYT Y

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Dog, Pig, Chimpanzee, Chinese hamster

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid