Cat#:FPA-37514P;Product Name:Rabbit Anti-Securin Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within the N terminal aa 2-51 ( ATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD ) of Human Securin (NP_004210). ;Species Reactivity:Human Predicted to work with: Mouse, Horse, Cat, Pig, Chimpanzee;Isotype:IgG;Application:IHC-P, WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within the N terminal aa 2-51 ( ATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD ) of Human Securin (NP_004210).
Species Reactivity:
Human Predicted to work with: Mouse, Horse, Cat, Pig, Chimpanzee
Isotype:
IgG
Application:
IHC-P, WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.