Rabbit Anti-Secretory lectin ZG16 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48308P

• Product Name:
• Rabbit Anti-Secretory lectin ZG16 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant full length protein (His-tag) corresponding to Human Secretory lectin ZG16 aa 17-167. (10aa N terminal His-tag. Produced in E.coli). Sequence: NAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQV RYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKG

• Species Reactivity:
• Human Predicted to work with: Rat

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• pH: 7.2 Constituents: 0.58% Sodium chloride, 99% Phosphate Buffer

• Clonality:
• Polyclonal

• Form:
• Liquid