Rabbit Anti-SCCPDH Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-37251P

• Product Name:
• Rabbit Anti-SCCPDH Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to a region within C terminal aa 324-373 ( QGPTQKQIDAASFTLTFFGQGYSQGTGTDKNKPNIKICTQVKGPEAGYVA ) of human SCCPDH (NP_057086).

• Species Reactivity:
• Human Predicted to work with: Horse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid