Cat#:FPA-37112P;Product Name:Rabbit Anti-Sar1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human Sar1 aa 128-158 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH). Sequence: PILILGNKIDRTDAISEEKLREIFGLYGQTT ;Species Reactivity:Mouse, Human Predicted to work with: Cow, Pig, Orangutan;Isotype:IgG;Application:WB, IHC-P, Flow Cyt;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide corresponding to Human Sar1 aa 128-158 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH). Sequence: PILILGNKIDRTDAISEEKLREIFGLYGQTT
Species Reactivity:
Mouse, Human Predicted to work with: Cow, Pig, Orangutan