Rabbit Anti-SAM domain-containing protein 5 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-37045P

• Product Name:
• Rabbit Anti-SAM domain-containing protein 5 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human SAM domain-containing protein 5 aa 1-56. Sequence: MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPA HRRRIL

• Species Reactivity:
• Human Predicted to work with: Mouse, Cow

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid