Cat#:FPA-36913P;Product Name:Rabbit Anti-S100 alpha Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human S100 alpha aa 10-59. The exact sequence is proprietary. (NP_006262.1). Sequence: ETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVM ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:WB, IHC-P, ICC/IF;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 0.87% Sodium chloride, 50% Glycerol, 49% PBS PBS without Mg2+ and Ca2+.;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human S100 alpha aa 10-59. The exact sequence is proprietary. (NP_006262.1). Sequence: ETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVM
Species Reactivity:
Human Predicted to work with: Mouse, Rat
Isotype:
IgG
Application:
WB, IHC-P, ICC/IF
Storage Buffer:
pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 0.87% Sodium chloride, 50% Glycerol, 49% PBS PBS without Mg2+ and Ca2+.
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.