Cat#:FPA-36689P;Product Name:Rabbit Anti-RRAGB Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human RRAGB (C terminal). The exact sequence is proprietary. Sequence: IDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLM ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish;Isotype:IgG;Application:WB;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;