Rabbit Anti-Rpt3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48221P

• Product Name:
• Rabbit Anti-Rpt3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• His6 tagged recombinant fragment: MEELGIVTPVEKAVEEKPAVKSYASLLAQLNGTVNNNSALSNVNSDIYFK LKKLEKEYELLTLQEDYIKDEQRHLKRELKRAQEEVKRIQSVPLVIGQFL , corresponding to N terminal aa 1-100 of yeast, S. cerevisiae Rpt3 (YTA2) protein sequence. Run BLAST with Run BLAST w

• Species Reactivity:
• Saccharomyces cerevisiae

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Whole antiserum

• Storage Procedures:
• Preservative: None Constituents: Whole serum.

• Clonality:
• Polyclonal

• Form:
• Liquid