Rabbit Anti-RPS23 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-36612P

• Product Name:
• Rabbit Anti-RPS23 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Rat RPS23 aa 15-64 (N terminal). The exact sequence is proprietary. (NP_511172). Sequence: SHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNS

• Species Reactivity:
• Rat Predicted to work with: Mouse, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 98% PBS, 2% Sucrose

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid