Rabbit Anti-RPS14 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-36584P

• Product Name:
• Rabbit Anti-RPS14 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human RPS14 aa 101-151. The exact sequence is proprietary. NP_001020242.1 Sequence: GGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRR L

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Chicken, Turkey, Xenopus laevis, Drosophila melanogaster, Zebrafish, Xenopus tropicalis

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid