Cat#:FPA-36539P;Product Name:Rabbit Anti-RPL7L1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human RPL7L1 aa 190-246. Sequence: HEIAFPGKHFQEISWFLCPFHLSVARHATKNRVGFLKEMGTPGYRGERIN QLIRQLN ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Pig, Orangutan;Isotype:IgG;Application:ICC/IF;Storage Buffer:pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;