Rabbit Anti-RPL6 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-36528P

• Product Name:
• Rabbit Anti-RPL6 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human RPL6 aa 25-75. The exact sequence is proprietary. NP_000961.2. Sequence: GKVKKGNLKAKKPKKGKPHCSRNPVLVRGIGRYSRSAMYSRKAMYKRKYS A

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig, Non human primates

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid