Product finder
Cat#:FPA-36496P;Product Name:Rabbit Anti-RPL35 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human RPL35 aa 51-100. Sequence: RKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEE ;Species Reactivity:Mouse, Rat, Human;Isotype:IgG;Application:IHC-P, WB;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 50% Glycerol, 0.87% Sodium chloride, 49% PBS PBS (without Mg2+, Ca2+);Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Rabbit Anti-RPL35 Polyclonal Antibody
Online Inquiry
- Product Name:
- Rabbit Anti-RPL35 Polyclonal Antibody
- Immunogen:
- Synthetic peptide corresponding to Human RPL35 aa 51-100. Sequence: RKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEE
- Species Reactivity:
- Mouse, Rat, Human
- Storage Buffer:
- pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 50% Glycerol, 0.87% Sodium chloride, 49% PBS PBS (without Mg2+, Ca2+)
- Storage Procedures:
- Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
Pre product:Rabbit Anti-RPL35 Polyclonal Antibody-FPA-36495P
Next product:Rabbit Anti-RPL35 Polyclonal Antibody-FPA-36497P