Cat#:FPA-36494P;Product Name:Rabbit Anti-RPL34 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within C terminal aa 68-117 ( SKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK ) of Human RPL34 (NP_000986). ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 97% PBS, 2% Sucrose;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within C terminal aa 68-117 ( SKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK ) of Human RPL34 (NP_000986).
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
Isotype:
IgG
Application:
WB
Storage Buffer:
Constituents: 97% PBS, 2% Sucrose
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.