Cat#:FPA-36474P;Product Name:Rabbit Anti-RPL27A Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human RPL27A aa 43-113. Sequence: INFDKYHPGYFGKVGMKHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAK NKTGAAPIIDVVRSGYYKVLG ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow, Chimpanzee, Cynomolgus monkey, Orangutan;Isotype:IgG;Application:IHC-P, ICC/IF;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;