Rabbit Anti-RPL26L1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-36470P

• Product Name:
• Rabbit Anti-RPL26L1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Fusion protein corresponding to Human RPL26L1 aa 1-145. Full length fusion protein. The identity of the protein partner is GST. Sequence: MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIR KDDEVQVVRG HYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVG IHPSKVVITRLKLDKD

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• pH: 7.3 Preservative: 0.05% Sodium azide Constituents: 49% PBS, 50% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid