Rabbit Anti-RPL18A Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-36452P

• Product Name:
• Rabbit Anti-RPL18A Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment within Human RPL18A aa 120-176. The exact sequence is proprietary. Sequence: RAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTT KRPNTFF

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid