Rabbit Anti-RPL18 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-36448P

• Product Name:
• Rabbit Anti-RPL18 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human RPL18 aa 111-160 (internal sequence). (NP_000970.1) Sequence: SRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPH

• Species Reactivity:
• Mouse, Rat, Human

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol PBS is without Mg2+ and Ca2+

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid